SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009050 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009050
Domain Number 1 Region: 345-483
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-31
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 2 Region: 938-1062
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-28
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 3 Region: 634-751
Classification Level Classification E-value
Superfamily C-type lectin-like 1.41e-20
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 4 Region: 2-56
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-19
Family Fibronectin type II module 0.0007
Further Details:      
 
Domain Number 5 Region: 117-191
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-18
Family C-type lectin domain 0.00092
Further Details:      
 
Domain Number 6 Region: 194-261
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000131
Family C-type lectin domain 0.0043
Further Details:      
 
Domain Number 7 Region: 1150-1210
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000021
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 8 Region: 839-887
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000577
Family C-type lectin domain 0.0033
Further Details:      
 
Domain Number 9 Region: 531-579
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000332
Family C-type lectin domain 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000009050
Domain Number - Region: 312-333
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0138
Family C-type lectin domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009050   Gene: ENSOPRG00000009873   Transcript: ENSOPRT00000009905
Sequence length 1301
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2881:79776:142501:1 gene:ENSOPRG00000009873 transcript:ENSOPRT00000009905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTLLGNANGASCAFPFKFQNKWYADCTNAGRSDGWLWCGTTTDYDTDKLFGFCPVKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTSSLTS
GLWIGLNSLSFNSGWQWSGGSPFRYLNWLPGSPSAQPGKSCVSLNPGKNAKWENLECVQK
LRYICKKGNTTLNPFVIPSETDVPTNCPSQWWPYAGHCYKIHREEKKIQKDALVACRKEG
GDLASIHSIEEFDFIISQLGYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXDGYWADRACERPLNYICKMASRAQTTGIVEEEPGCQKGWKRHGFYC
YYIGRTLSTFTEANQTCINEKAYLTTVEDRYEQAFLTSLIGLRPEKYFWTGLSDIQNKGT
FQWTIDEEVKFTHWNLDMPGRKAGCVAMRTGIAGGLWDILKCEEKAKFVCKQWAEGVTRP
PEPTTTPEPRCPEDWGTSGKTSLCFKXXXXXXXXXXXXXXXXXXXXXXXXELASINNKEE
QLIIWRLITATGSYHELFWLGLTHGGTSEGFTWSDGSPXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXQTLKPEPTPAPQDNPPVTEDGWVIYKDYQYYFS
KEKETMDNARAFCKKNFGDLVSIKSESEKKFLWKYXXXXXXXXXXXXXXXXXXXXXXXWM
DGSKVDYVAWATGEPNFANEDENCVTMYSNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXF
LTYHMKDSTFNVWTGLNDINSEHTFLWTDGRGVHYTNWGKGFPGGRRSSLSYEDXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSLRRFSTTVPTDGFIQYGRSSYSLMKLKLQ
WHEADKYCKSVTSLIASILNPYSNAFAWMQLQPHNVPVWIALNSNLTNNEYVWTDRWRVR
YTNWAADEPKLKSACVYLDIDGYWKTAYCNESFYFLCKRSDEIPATEPPQLPGRCPESXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXKWLWVNNNAVSFVNWNTGDPSGERNDCVLLDASSGFWNNIHCSSYKGYIC
KRPKIVDPTPTHKEVTTKXDSRKMAPSRSSSNMAGVVVVVVLLILAGAGFAAYFFYKKRR
MHIPPESTFENTLYFNSRLSPGTSDTKDLMGNIEQNEHAVI
Download sequence
Identical sequences ENSOPRP00000009050 ENSOPRP00000009050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]