SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009202 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009202
Domain Number 1 Region: 20-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.05e-86
Family Carbonic anhydrase 0.00000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009202   Gene: ENSOPRG00000010068   Transcript: ENSOPRT00000010072
Sequence length 337
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2640:61298:66444:1 gene:ENSOPRG00000010068 transcript:ENSOPRT00000010072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFALLLEVIWILAADGGQHWTYEGPHGQEHWPASYPECGNDAQSPIDIRTDSVTVAPEL
PILQPHGYEQPGTEPLDLHNNGHTVQLSLPPTLYLSGLPRKYVAAQLHLHWGRQGSPGGS
EHQINSEAAAAELHIVHYDSDSYESLSEAAQRPQGLAVLGILIEAGDTENPAYEHILQHL
HEIRHKDEKTSVPPFNVGGLLPPQLEHFFRYNGSLTTPPCYQSVLWTVFSRRAQISVEQL
ERLQTTLFSTEEEEPSELLAENFRIPQPLNQRGVLASFNPAGSLYSTGEMLSIAVGILVG
CLCLLLALYFIARKIRKKRLGNRKSVVFTSARTTAEA
Download sequence
Identical sequences ENSOPRP00000009202 ENSOPRP00000009202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]