SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009300 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009300
Domain Number 1 Region: 1-272
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 2.86e-79
Family Phosphoglycerate kinase 0.0000000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009300   Gene: ENSOPRG00000010190   Transcript: ENSOPRT00000010179
Sequence length 272
Comment pep:known_by_projection scaffold:pika:scaffold_37983:36033:44433:1 gene:ENSOPRG00000010190 transcript:ENSOPRT00000010179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAAELKSLLGXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGKIKADPAKVENFRASLSKLGDV
YVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADK
IQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKI
TLPVDFVTADKFDENAKTGQATVASGIPAGWM
Download sequence
Identical sequences ENSOPRP00000009300 ENSOPRP00000009300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]