SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009319 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009319
Domain Number 1 Region: 1135-1263
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 3.92e-52
Family Methionine synthase SAM-binding domain 0.0000104
Further Details:      
 
Domain Number 2 Region: 21-210
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.22e-46
Family Homocysteine S-methyltransferase 0.00041
Further Details:      
 
Domain Number 3 Region: 768-920
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.96e-36
Family Cobalamin (vitamin B12)-binding domain 0.0000107
Further Details:      
 
Domain Number 4 Region: 508-644
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 5.23e-34
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.013
Further Details:      
 
Domain Number 5 Region: 927-1067
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 2.09e-32
Family Methionine synthase SAM-binding domain 0.00013
Further Details:      
 
Domain Number 6 Region: 664-753
Classification Level Classification E-value
Superfamily Methionine synthase domain 3.14e-27
Family Methionine synthase domain 0.000033
Further Details:      
 
Domain Number 7 Region: 357-440
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 3.4e-19
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009319   Gene: ENSOPRG00000010174   Transcript: ENSOPRT00000010198
Sequence length 1264
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1435:247600:421751:1 gene:ENSOPRG00000010174 transcript:ENSOPRT00000010198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSAALQELSGSAGMKNTVRDDIEAILQKRIMVLDGGMGTMIQRYKLSEEHFRDEEFKDHA
RSLKGNNDILSITQPDIVYQIHKDYLLAGADIIETNTFSSTSIAQADYGLEHLXXXXXXX
XXXXXXXXXXXXXXXXXKRFVAGALGPTNKTLSVSPSVERPDYRNFTFDELVEAYQEQAR
GLLDGGVDILLIETIFDTANAKAAVFALQQLFQEKYTPRPIFXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGLPNTFGDYDETP
TIMATHLKXXXXXXXXXXXXXXXXXXXXXXXEIAETVKNCKPRVPPASLFEGHMLLSGLE
PFRIGPYTNFVNIGERCNVAGSKKFAKLIMAGNYEEALSVAKEQVQMGAQVLDVNMDDGM
LDGPSAMSRFCNLIASEPDIAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXATETDVKIRVCTRAYHLLVKKLGFNPNDIIFDPNIL
TIGTGMEEHNLYAINFIHATKVIKETLPGVRISGGLSNLSFSFRGMETIREAMHSVFLYH
AIKFGMDMGIVNAGNLPVYDDIHKELLQLCEDLIWNKDPEATEKLLRYAQTHGKDGKKNV
QSDEWRNNPVEERLEYALVKGIEKYIIEDTEEARLNQEKYPRPLNIIEGPLMNGMKVVGD
LFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREANRIQNGTLEEEDPYQGTIVLATVK
GDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEMI
FVAKEMERLAIKIPLLIGGATTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXCSQLLDENL
KDDYFEEIIEEYEDIRQDHYESLKERRYLPLIQARKNAFQIDWLSEPYPVKPTFIGTQVF
EDYDLQKLVNYIDWKPFFDVWQLRGKYPNRGFPKIFDDKTVGEEARKVYDDAQNMLNTVI
SEKKLQAKGIVGFWPAQSVQDDIHLYAEDAVPQAAEPIATFYGLRQQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFAEEL
HERVRRELWAYCGSEQLDVADLRRLRYEGIRPAPGYPSQPDHTEKLTMWRLANIEESTGI
RLTESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQIEDYALRKKMSVAEVEKWLGPILG
YDTD
Download sequence
Identical sequences ENSOPRP00000009319 ENSOPRP00000009319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]