SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009329 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009329
Domain Number 1 Region: 235-337
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.54e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000189
Family HLH, helix-loop-helix DNA-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009329   Gene: ENSOPRG00000010205   Transcript: ENSOPRT00000010210
Sequence length 846
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_334:913063:955630:1 gene:ENSOPRG00000010205 transcript:ENSOPRT00000010210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKL
LSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXSGFGKKNKDMSTERDFFMRMKCTVTNRGRTVNLKSAT
WKVLHCTGQVKVYSDCPPHNSLCGYKEPLMSCLIIMCEPIQHPSHMDIPLDSKTFLSRHS
MDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRM
LAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMA
MNSIFDNSGEVAVSDKSDFLFTKLKEEPEELAQLAPTPGDTIISLDFGNQSFEDSSAYGK
AVLPPGQPWVAEVRSHSTQSDAGSLPAFSVPQVAAPGSTTPSASSNSSCSTPSSPEDYYT
SLEDDLKIEMIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLSPICPEEP
IVPESPQPPPQHCFSTMTNIFQPLVPTASESPFLLDKYPPPLEGKKTEPEHHPMSSIFFD
AGHKTAMPPCCGQASTPLSSMGGRSNTQWPPDPPLQFGSTKWSAGAQHTEPLAPVSMFKT
RSAKGFRPGAADMMSPAVAALSNKLKLKRQLEYEKQGFQDVSWGDPPGSSASHLMWKRMK
SLRGGGCPLLPDKLLDANEFIQNPLRGLGQPLRHLPPPQRPSTLSSGENAKSGFPLQGYA
PPYQDYNNQPLTHKMPGLASRLLGPSFEPYLLPELTRYDCEVNVPVPGSSTLLQGGDLLR
ALDQAT
Download sequence
Identical sequences ENSOPRP00000009329 ENSOPRP00000009329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]