SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009335 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009335
Domain Number 1 Region: 17-340
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.19e-115
Family Aldose 1-epimerase (mutarotase) 0.0000000000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009335   Gene: ENSOPRG00000010222   Transcript: ENSOPRT00000010216
Sequence length 342
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1539:160905:204509:1 gene:ENSOPRG00000010222 transcript:ENSOPRT00000010216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSVTRSVFGELPSGAGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFA
ELEGYLQKQPYFGAVIGRVANRIAKGTFMLDGKEFQLPINRGPNSLHGGFRGFDKVLWSP
QVLPNGVQFSRVSPDGEEGYPGELKVWVTYTLDGGELMVNYRAQTSRTTPVSLTNHSYFN
LAGQGSPNIYDHEVTIEADAFLPVNEALIPTGEVAPVQGTAFDLRQPVELGKHLQQFSID
GFDHNFCLKQSKEKHFCARVRHAASGRVLEVYTTQPGVQFYTANFLDGTLKGKGGAVYPK
HCGFCLETQNWPNAVNQSNFPPVLLRPEEEYNHTTWFKFSVA
Download sequence
Identical sequences ENSOPRP00000009335 ENSOPRP00000009335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]