SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009532 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009532
Domain Number 1 Region: 236-478
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.51e-55
Family Decarboxylase 0.000000493
Further Details:      
 
Domain Number 2 Region: 9-206
Classification Level Classification E-value
Superfamily PRTase-like 1.31e-42
Family Phosphoribosyltransferases (PRTases) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009532   Gene: ENSOPRG00000010443   Transcript: ENSOPRT00000010433
Sequence length 480
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4236:918769:947419:1 gene:ENSOPRG00000010443 transcript:ENSOPRT00000010433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAEAALAPLVTGLYDVQAFKFGDFVLTSGLSSPVYIDLRGMVSLQRLLSPVADILFQT
AQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKESKDYGTKRLVEGTINPGDTCL
IIEDVVTSGSSVLETVEVLQREGLKVTDAIVLLDREQGGKDKLQSHGIRLHSVCTLSKML
EILEQQKKIDALTVGRVKRFIQENVFTAADPNGSLPSMKAVPKELSFAARAELPAAHPVA
SKLFRLMEKKATNLCLSADVSEARELLELADMLGPSICMLKTHVDILSDFTLDVVKQLTM
LAERHEFLVFEDRKFADIGNTVKKQYEGGVFKIASWADLVNAHVVPGAGVVKGLQEVGLP
LHRGCLLIAEMSSAGSLATGSYTTAAVKMAEEHSEFVIGFISGSRVSPKPEFLHLTPGVQ
LEAGGDNLGQQYNSPQEVIRQRGSDIIIVGRGIIAAANRLEAAEMYRKAAWEAYLNRLDA
Download sequence
Identical sequences ENSOPRP00000009532 ENSOPRP00000009532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]