SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009599 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009599
Domain Number 1 Region: 9-475
Classification Level Classification E-value
Superfamily ALDH-like 1.72e-154
Family ALDH-like 0.000000000000946
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009599   Gene: ENSOPRG00000010509   Transcript: ENSOPRT00000010505
Sequence length 475
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4334:257754:300932:-1 gene:ENSOPRG00000010509 transcript:ENSOPRT00000010505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAGMAELPTPLTNLKIQYTKIFINNEWHDSVSGKKFPVLNPATEEQICLVEEGDKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMESINAGKLFPNAYLMD
LGGCIKTLRYCAGWADKTLGRTMPIDGDFFCYTRHEPVGVCGQIIPWNFPLVMLIWKIGP
ALSCGNTVVVKPAEQTPLTALHVASLVKEAGFPPGVVNIVPGYGPTAGAAISNHMDVDKV
AFTGSTEVGKLIKEAAGKTNLKRVTLELGGKSPCIVFADADLDMAVEFAHQGLFYHQGQC
CIAASRLFVEESIYDEFVRRSVERAKKYVLGNPLAPEVNQGPQIDKEQYTKILDLIESGK
KEGAKLECGGGPWGKKGYFVQPTVFSNVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRAN
NTTYGLSAGIFTRDLDKAVTVSAALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRE
Download sequence
Identical sequences ENSOPRP00000009599 ENSOPRP00000009599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]