SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009812 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009812
Domain Number 1 Region: 46-185
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 6.15e-46
Family Molybdopterin synthase subunit MoaE 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009812   Gene: ENSOPRG00000010746   Transcript: ENSOPRT00000010741
Sequence length 188
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3044:465269:475135:-1 gene:ENSOPRG00000010746 transcript:ENSOPRT00000010741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLEINCSTFSREMKLPSSPPLVEGSAFEPCRKDMDEVEEKPKDIIKFTTEKLAVEEIS
QLVISPPCGAVSLFVGTTRNNFEGRKVLSLEYEAYLPMAENEIRKICGDIRQRWPVAHIA
VFHRLGLVPVSEASVVIAVSSAHRAASLEAVSFAIDQLKAKVPIWKKXXYEESSSWKRNK
ECFWASKD
Download sequence
Identical sequences ENSOPRP00000009812 ENSOPRP00000009812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]