SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009858 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009858
Domain Number 1 Region: 67-201
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 5.89e-40
Family Band 7/SPFH domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000009858
Domain Number - Region: 207-325
Classification Level Classification E-value
Superfamily ALDH-like 0.016
Family ALDH-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009858   Gene: ENSOPRG00000010798   Transcript: ENSOPRT00000010790
Sequence length 356
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1651:145592:148400:-1 gene:ENSOPRG00000010798 transcript:ENSOPRT00000010790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARAARGTGTLLLRGSVQACVRAPHRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
DPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIKDI
HVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQA
AGEASAVLAKAKAKAEAIRILAEALTQHNGNAAASLTVAEQYVNAFSKLAKDSNTILLPS
NPGDVTSMVAQAMGVYGALTKAPGPAAQDSISRGNSRDAQGTDTGLDVELDRVKLS
Download sequence
Identical sequences XP_004581073.1.84141 ENSOPRP00000009858 ENSOPRP00000009858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]