SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010008 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010008
Domain Number 1 Region: 110-292
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 7.98e-51
Family Isochorismatase-like hydrolases 0.0000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010008   Gene: ENSOPRG00000010970   Transcript: ENSOPRT00000010958
Sequence length 299
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5537:264246:287683:1 gene:ENSOPRG00000010970 transcript:ENSOPRT00000010958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAEPAVPALAGGAGAVAGTPSGAVPVLFCFSVFARPSSVPHGAGYELLIQKFLSLYG
DQIDMHRKFVVQLFVEEWGQYVDLPKGFAVSERCKVRLVPLQIQLTTLGNLMPSSTVFFC
CDMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIVTEQYPKGLGSTVQEIDLTGVKLV
LPKTKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCVQQTALELVGRGIEVHIVADATSS
RSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Download sequence
Identical sequences ENSOPRP00000010008 ENSOPRP00000010008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]