SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010094 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010094
Domain Number 1 Region: 1-52
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000379
Family HLH, helix-loop-helix DNA-binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010094   Gene: ENSOPRG00000011063   Transcript: ENSOPRT00000011053
Sequence length 186
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3263:28329:29104:1 gene:ENSOPRG00000011063 transcript:ENSOPRT00000011053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKKRRARINVSLEQLKTLLEKHYSHQIRKRKLEKADILELSVKYMKSLQTLQGLWPVSI
GAEFASCSRGCLPGVSLLLRRGEEGSGGPSCPLVLERPAGCSTMDSGRPGPEAPSSRGPC
AWARWAPASSACGPPSTPPLRLLPGDLPGSSPSVLAPPPASRSPPESPGPGLRVWRPWGP
EHASHS
Download sequence
Identical sequences ENSOPRP00000010094 ENSOPRP00000010094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]