SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010108 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010108
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 6.15e-32
Family Ribosomal L11/L12e N-terminal domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 75-147
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 5.36e-16
Family Ribosomal protein L11, C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010108   Gene: ENSOPRG00000011078   Transcript: ENSOPRT00000011068
Sequence length 164
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2295:481773:483727:-1 gene:ENSOPRG00000011078 transcript:ENSOPRT00000011068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITV
KLTIQNRQAQIEVVPSASALIIALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSL
ARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS
Download sequence
Identical sequences ENSOPRP00000010108 ENSOPRP00000010108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]