SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010126 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010126
Domain Number 1 Region: 34-169
Classification Level Classification E-value
Superfamily Ribosomal protein S7 4.19e-22
Family Ribosomal protein S7 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010126   Gene: ENSOPRG00000011102   Transcript: ENSOPRT00000011086
Sequence length 169
Comment pep:novel scaffold:pika:scaffold_12928:50459:51730:1 gene:ENSOPRG00000011102 transcript:ENSOPRT00000011086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPVAKAALGWTGLALGVRPTVCWLPGLTQVRWSRYGPEYRDPLVEKDYYRKPAAELTE
EEKYDRELKRTQLIKAAPATRTSSVFHDPVISKFTNMMMKDGNKVLARSLMTQTLEAIKR
KQFAKYHAASAEERTSIELNPYVIFHQALKNCEPVLGLISVLRGGHFYQ
Download sequence
Identical sequences ENSOPRP00000010126 ENSOPRP00000010126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]