SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010141 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010141
Domain Number 1 Region: 139-205
Classification Level Classification E-value
Superfamily RILP dimerisation region 7.06e-17
Family RILP dimerisation region 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010141   Gene: ENSOPRG00000011112   Transcript: ENSOPRT00000011103
Sequence length 211
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_198:252411:261359:-1 gene:ENSOPRG00000011112 transcript:ENSOPRT00000011103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPPVRGTEEEEEEEDDGDEGDEGDDAGPEGALAKSPSQLTAEDVYDISYVVGRELMAL
GSDPRVTQLQFKIVRVLELLEALVSEGNLTAEALRMERDSLRAEVAGLRRQLPPASGEMT
LGPDKMVVDLTDPDRPRFTLQELRDVLQERNQLKSQLLLLQEELQCYKSGLIPPRESPGR
RGGDAMAPGAGSRKEKTIIRKLFSFRSGKQI
Download sequence
Identical sequences ENSOPRP00000010141 ENSOPRP00000010141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]