SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010154 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010154
Domain Number 1 Region: 107-223
Classification Level Classification E-value
Superfamily FKBP-like 9.82e-37
Family FKBP immunophilin/proline isomerase 0.000000941
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010154   Gene: ENSOPRG00000011126   Transcript: ENSOPRT00000011119
Sequence length 224
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4397:165612:174708:-1 gene:ENSOPRG00000011126 transcript:ENSOPRT00000011119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQDHGSDSXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPPKYTKSVLKKGD
KTNFPKKGDVVHCWYTGTLQDGTVFDTNVQTSSKKKKNAKPLSFKVGVGKVIRGWDEALL
TMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLIFEVELVDID
Download sequence
Identical sequences ENSOPRP00000010154 ENSOPRP00000010154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]