SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010164 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010164
Domain Number 1 Region: 141-204
Classification Level Classification E-value
Superfamily RILP dimerisation region 3.01e-19
Family RILP dimerisation region 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000010164
Domain Number - Region: 25-97
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0072
Family Spectrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010164   Gene: ENSOPRG00000011137   Transcript: ENSOPRT00000011129
Sequence length 232
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_198:273186:286734:-1 gene:ENSOPRG00000011137 transcript:ENSOPRT00000011129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTV
VEAQGKALIEQKVELEADLQTKEQEMGSLRAELGRLRERLQGERGQDQKEEPEAEPSGED
CVSDAEKAAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEMEEENRI
PPPPPAAHPRLSPQPESGIKRLIFTAIMPMVAAGLIIDDPTLQPVRRLVSLI
Download sequence
Identical sequences ENSOPRP00000010164 ENSOPRP00000010164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]