SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010519 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000010519
Domain Number - Region: 6-35
Classification Level Classification E-value
Superfamily DNA clamp 0.0847
Family DNA polymerase processivity factor 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010519   Gene: ENSOPRG00000011533   Transcript: ENSOPRT00000011529
Sequence length 383
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4105:5018:10727:1 gene:ENSOPRG00000011533 transcript:ENSOPRT00000011529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCLITGGNIKVLGKAVHSLSRIGDELYLEPLEDGXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLGEAVLPFPQALSEVTLGIAQGRRVVLRS
YQEEDEADSNTKTMVTEMSLGEADFQELQAREGVAVTFCLKEFRELLSFAESANLPLSVH
FDAPGRPAIFTVEDSTLDGHFVLATLSEAENWSPAPPLQAHSTPHQEDFTSDDMDAYMIA
METTVGSEGSRVLPSISVSPGPQRSDSPVWSSEEDGDEAEPSTIPGTPPPKKFRSLFFGS
ILTPAHSPQGPSPVLAEDSDGEG
Download sequence
Identical sequences ENSOPRP00000010519 ENSOPRP00000010519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]