SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010826 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010826
Domain Number 1 Region: 258-416
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.38e-32
Family Eukaryotic ODC-like 0.0000178
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000010826
Domain Number - Region: 147-195
Classification Level Classification E-value
Superfamily PLP-binding barrel 0.00024
Family Alanine racemase-like, N-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010826   Gene: ENSOPRG00000011866   Transcript: ENSOPRT00000011863
Sequence length 448
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3138:20902:37925:-1 gene:ENSOPRG00000011866 transcript:ENSOPRT00000011863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFIDDANYSIGLLDEGTNLGNVIDNYVYEHTLXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXNAKVLLHIATEDNIGGGEGSMKFGTSLKNCRHL
LECAKELDVQIIGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVNHVISPLLDVYFPEGSGIKIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSA
GVEKTESDEPAFVYYMNDGVYGSFASKLSEDLNAIPEVHKKCKADEPLFPSSLWGPSCDA
LDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFERPAVYYMMSFRDWYEMQDAGI
TSDTMMKNFFFVPSCIQLSQEDSFPTEA
Download sequence
Identical sequences ENSOPRP00000010826 ENSOPRP00000010826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]