SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010905 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000010905
Domain Number - Region: 36-99
Classification Level Classification E-value
Superfamily DNA clamp 0.00718
Family DNA polymerase processivity factor 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010905   Gene: ENSOPRG00000011955   Transcript: ENSOPRT00000011952
Sequence length 205
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_151:211851:215989:-1 gene:ENSOPRG00000011955 transcript:ENSOPRT00000011952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQHAQDEGERYSLVASLDNVRNLSTVLKAIHFQEHATCFATKNGLRVTVENAKCVQ
ANAFIQAGIFQEFTVQEESVTFRINLTVLLDCLSIFGSSPMPGTCTALRMCYQGYGHPLM
LFLEEGRVVTVCKISTQEPEETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQIT
MSPDKPYFRVSTFNASSHLDYKDSD
Download sequence
Identical sequences ENSOPRP00000010905 ENSOPRP00000010905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]