SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011010 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011010
Domain Number 1 Region: 25-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 8.64e-69
Family Carbonic anhydrase 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011010   Gene: ENSOPRG00000012069   Transcript: ENSOPRT00000012063
Sequence length 307
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3133:112608:456794:-1 gene:ENSOPRG00000012069 transcript:ENSOPRT00000012063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPF
LTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQ
GSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKXXXXXXXXXXXXXX
XXXXXXXXXXXDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITR
MQMHSLRLLSQSQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYR
VNEWLLK
Download sequence
Identical sequences ENSOPRP00000011010 ENSOPRP00000011010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]