SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011199 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011199
Domain Number 1 Region: 565-699
Classification Level Classification E-value
Superfamily HCP-like 9.02e-27
Family HCP-like 0.0059
Further Details:      
 
Domain Number 2 Region: 358-463
Classification Level Classification E-value
Superfamily HCP-like 2.75e-23
Family HCP-like 0.0014
Further Details:      
 
Domain Number 3 Region: 116-169
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-20
Family Fibronectin type II module 0.00085
Further Details:      
 
Domain Number 4 Region: 258-322
Classification Level Classification E-value
Superfamily HCP-like 0.0000000000772
Family HCP-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011199   Gene: ENSOPRG00000012251   Transcript: ENSOPRT00000012272
Sequence length 787
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2491:164366:198133:-1 gene:ENSOPRG00000012251 transcript:ENSOPRT00000012272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVQSGLTLLLCAVLLGPAVTSSDEEGSQDESLDSKSVPPDESVKDHATAGRVVAGQIFL
DPEESELESPVQEEEDSLKNQEGESVTEEMNFLESPNPEIKEYEEPKKVRKPALTAIEGT
AHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEATKRRQMQ
EAEMMYQTGMKILNGSSKKNQKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYRY
WAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDLI
QYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMYS
EGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXLFKNVCERGRWSERLMTAYNSYKDGDYNAAVIQYLLLAEQGYEVAQSNAAFILDQRE
ATIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQQ
HSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVVYFLQYI
RETNIRDMFTHLDMDQLLGPEWDLYLMTVIALLLGTVIAYRQRQHQDMPGPRPPGPRPAP
PQQEGQQ
Download sequence
Identical sequences ENSOPRP00000011199 ENSOPRP00000011199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]