SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011625 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011625
Domain Number 1 Region: 44-220
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000377
Family Quinoprotein alcohol dehydrogenase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011625   Gene: ENSOPRG00000012725   Transcript: ENSOPRT00000012729
Sequence length 993
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4376:358327:431500:-1 gene:ENSOPRG00000012725 transcript:ENSOPRT00000012729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPCTPRFWLLAALLVPAAAVYEDQVGKFDWRQQYVGKLKFASLEFSPGSKKLVVATEK
NVIAALNSRTGEILWRHVDKGTAEGAVDAMLLHGQDAITVSNGGRIMRSWETNIGGLNWE
ITLDSGSFQALGLVGLQESVRYIAVLKKTTLALHHLTIGHLKWVENLPESDSFHYQMVYS
YGSGVVWALGIVPFSHVNIVKFNVEDGEIVQQVRVSAPWLQHLTGACGIVDDAVLVCPDP
SSRSLQTLALETEWELTQIPLQPLDLEFGSGFQPRVLPTQPNPVDPSRAQFFLQLSETHY
ALLHYHHGALSLLKNFPQTALVSFATTGEKTVAAVLTCRNEVQKPSSSEDGPMGSLAEKS
SPKNSLVCFNQTYVINLYLVETGRRLLDTAITFTLEQNGTRPERLYIQVFLKKDDSAGYR
ALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGL
LGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEIHIDTLARDEFNLQKMMVMVT
ASGKLFGIESSSGTILWKQYLPNIKPDSSFKLMVQRTTAHFPHPPQCTLLVKDKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXSLNPNLLAVVTESTDTHHERTFIGIFLIDGVTGRIIHSSVQKKARG
PVHIVHSENWVVYQYWNTKARRNEFTALELYEGTEQYNATAFSSLDRPQLPQVLQQSYIF
PSSISAMEATITERGITSRHLLIGLPSGAVLSLPKALLDPRRPEIPTEQSREENLIPYSP
DVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDY
DYVLISSVLFGLVFATMITKRLAQVKLLNRAWR
Download sequence
Identical sequences ENSOPRP00000011625 ENSOPRP00000011625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]