SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011637 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011637
Domain Number 1 Region: 122-372
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.96e-79
Family Carbonic anhydrase 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011637   Gene: ENSOPRG00000012740   Transcript: ENSOPRT00000012743
Sequence length 437
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2313:75238:79880:1 gene:ENSOPRG00000012740 transcript:ENSOPRT00000012743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVGPCPCLPRLTPGPTAAAAVLLLLLPPLPLQVCAHPQSLPQEKGDPAPGGGSSGEDD
PPGEEDLPSEEDPQGQEDPGGGEPTEENSLKPEDRPTARAPVHTHGPPNNAHRGRKGEDH
SHWRYGGDPPWPQVSPACAGRFQSPVNIRPELTAFCPALRPLELLGFELPRLPELRLRNN
GHTVQLTLPPGLQLALAPGQEYRALQLHLHWGSADRPGSEHTVDGHRFPAEIHVVHLSTA
FAEMGQALGRPGGLAVLAAFLQEGPEENSVYEQLLSHLGEIPEEGSETWIPGLDVSALLP
SDLSRYFRYEGSLTTPPCSQGVIWTVFNQTVKLSAKQLHTLSGSLWGSGDSRLQLNFRAA
QPLDGRMIEASFPTNGDGSPKPVHLHSCLAAGDILALIFGFLFAATSIAFLVQMKKHRIE
TKAGVSYHPAEMAETGA
Download sequence
Identical sequences ENSOPRP00000011637 ENSOPRP00000011637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]