SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011640 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011640
Domain Number 1 Region: 129-368
Classification Level Classification E-value
Superfamily vWA-like 1.29e-70
Family Integrin A (or I) domain 0.00000241
Further Details:      
 
Domain Number 2 Region: 1124-1308
Classification Level Classification E-value
Superfamily Fibronectin type III 4.33e-35
Family Fibronectin type III 0.00000374
Further Details:      
 
Domain Number 3 Region: 1515-1716
Classification Level Classification E-value
Superfamily Fibronectin type III 5.25e-35
Family Fibronectin type III 0.00097
Further Details:      
 
Domain Number 4 Region: 624-708
Classification Level Classification E-value
Superfamily Integrin beta tail domain 6.28e-17
Family Integrin beta tail domain 0.0025
Further Details:      
 
Domain Number 5 Region: 1033-1104
Classification Level Classification E-value
Superfamily CalX-like 0.000000000301
Family CalX-beta domain 0.0019
Further Details:      
 
Domain Number 6 Region: 28-77
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000214
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.019
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000011640
Domain Number - Region: 507-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00179
Family Integrin beta EGF-like domains 0.039
Further Details:      
 
Domain Number - Region: 467-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0391
Family Integrin beta EGF-like domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011640   Gene: ENSOPRG00000012719   Transcript: ENSOPRT00000012747
Sequence length 1807
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1756:359503:382185:1 gene:ENSOPRG00000012719 transcript:ENSOPRT00000012747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPRSSLWARLLLVTLLSASLPGITANRCKKAQVKSCTECIRVDKDCAYCIDELFTERR
CNTPEELLAAGCRRESVVIMESSFEITEESQIDQKLHRSQVSPQGMYVRLRPGEERLFDL
QVFEPLESPVDLYILMDFSNSMSDDLDNLKQMGSNLAQVLSKLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTKDANEFRDKLQGERISGNLDAPEGGFDAIL
QTAVCTRAIGWRPDSTHLLVFSTESAFHYEADGANVLISIMSRNDERCHLDATGTYTQYN
MQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAFNRIRSNLDIRALDSPRGLRTEVTSRMYQKTATGSFHIRRGEVGTYQVQLRALEAVDG
KPVCQLPEEDQKGNIHLKPSFSDGLHLDVGIMCDKCACELEKEVQSARCDFHGDFMCGHC
VCNEGWSGSTCNCSTGALSDVTPCMRDGDDKPCSGRGECQCGRCVCYGESRYEGQFCEYD
NVQCPRTSGVLCNDRGRCTMGQCVCEPGWTGPSCDCPLSNATCIDSNGXXXXXXXXXXXX
XXXXXXXXXXXXXICEINYISLCLCESLRSCVQCQASGTGAKKGRTCEECSFKVTMVDEL
KKAEEVIGYCSFRDEDDDCTYSYTVEGDGSPGPNSTVLVQRKKDCPPGNFWWLLLILLPL
LALLLLLCCKYCACCKACLALLPCCSQGHMVGFKEDHYMLRENLMASDHLDTPMLRSGNL
KGRDTVRWKITNNVQRPGHAAHTASTNPGELVPYGLSLRLARLCTENLLKPDTRECSQLR
QEVEENLNEVYRQITGAHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRAAKPALLKLTEK
HVEQGAFHELKVARGYYTLTAEQDARGMVEFQEGVELVDVRVPLFMRPEDDDEKQLLVEA
IDVPVGTATLGRRLVNITIIREQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXDYVPVEGELLFHPGETWKELKVTLLEPQEVDSLLRGRQNRRFNIQLS
NPKFGARLGQPQSATIIIGDQDEVDQDFVSQTQSSFPLPHVDLGAPQNPNAKAAGSRKIH
FNWLPPPGKPAGYRIKYWIQGDSEAEAHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQGE
GPYSTLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLVNEDN
RPIGPMKKVLVDSPKSRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPM
SIPIIPDIPIVDAQGGEDYESFLMYSDDVLRSPAGSQRPSVSDDTGGGGWNFEPVLGAEL
DLRRVTWRLPPELIPRLSASSGRSSDAHEGGADGQGDPRPRCATPRPPGEHLVNGRMDFA
FPGSANSLHRMTTATSSYGTHLSPHLPRGVHSTSSTLTRDYHSLTRTEHSHMATLPRDYS
TLSSLSSQDSRLMAGVPDTPTRLVFSALGPTSLKVSWQEPQCDRALLGYSVEYQLLTGGE
LRRLTVPSPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGIITIESQVHPQNPLCPL
PGSTFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDILGYLVTCEIVHGGGPATTFR
VDGDNPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSHAGL
FQHPLQSEYSTVTSTHTSTTEPFLMDGLALGSQHLEASGSLTRHVTQEFVSRTLTTSAQV
DQQFFHS
Download sequence
Identical sequences ENSOPRP00000011640 ENSOPRP00000011640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]