SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011790 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011790
Domain Number 1 Region: 55-326
Classification Level Classification E-value
Superfamily Radical SAM enzymes 2.49e-75
Family MoCo biosynthesis proteins 0.00000402
Further Details:      
 
Domain Number 2 Region: 482-625
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis protein C, MoaC 1.7e-49
Family Molybdenum cofactor biosynthesis protein C, MoaC 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011790   Gene: ENSOPRG00000012916   Transcript: ENSOPRT00000012911
Sequence length 628
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2775:90913:113341:-1 gene:ENSOPRG00000012916 transcript:ENSOPRT00000012911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTARPVTRMVRLLLRPGTRSCSSGLPVSQPHPGEEPSIRRQFLREHVVPFSAFLTDSFGR
QHSYLRISLTEKCNLRCQYCMPEEGISLTPKADLLTTEEILTLARLFVKEGVDKIRLTGG
EPLIRPDVVDIVAQLHQLEGLRTIGVTTNGINLARLLPQLQKAGLSAINISLDTLVPAKF
EFIVRRKGFHKVMEGIHKAIELGYSPVKVNCVVMRGLNEDELLDFVALTKGLPLDVRFIE
YMPFDGNKWNFKKMVSYKEMLDAIRQQWPELEKLPEEESSTAKAFKIPGFQGQVSFITSM
SEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQELLAIIGAAVGRKKRQHA
GMFSISQTKNRPMILIALFPMPRASPQARLSIFSWDPHRVQGLRCQVSFSNQMVTLWKRY
SHPQPHTPAQQWPGSGCLQRHYSSHVHSDAKSKCLSSASQAPATCSGPLPTSDELTHVDS
EGRAAMVDVGRKPETERVAVASALVLLGPVAFELVRQNQLKKGDALLVAQLAGIQAAKLT
SQLIPLCHQVTLSHVQVQLELESASHTVAIQATCRARGPTGVEMEALTSASVAALLYDMC
KAVSRDIVVSEVKLISKTGGQRGDFHRA
Download sequence
Identical sequences ENSOPRP00000011790 ENSOPRP00000011790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]