SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011810 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011810
Domain Number 1 Region: 459-708
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.57e-59
Family Eukaryotic proteases 0.0000404
Further Details:      
 
Domain Number 2 Region: 366-459
Classification Level Classification E-value
Superfamily Kringle-like 2.08e-34
Family Kringle modules 0.0001
Further Details:      
 
Domain Number 3 Region: 188-279
Classification Level Classification E-value
Superfamily Kringle-like 1.23e-33
Family Kringle modules 0.00014
Further Details:      
 
Domain Number 4 Region: 91-189
Classification Level Classification E-value
Superfamily Kringle-like 1.96e-30
Family Kringle modules 0.00037
Further Details:      
 
Domain Number 5 Region: 282-363
Classification Level Classification E-value
Superfamily Kringle-like 7.73e-29
Family Kringle modules 0.00022
Further Details:      
 
Domain Number 6 Region: 20-106
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 8.63e-17
Family Hairpin loop containing domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011810   Gene: ENSOPRG00000012929   Transcript: ENSOPRT00000012933
Sequence length 710
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4145:176718:180601:-1 gene:ENSOPRG00000012929 transcript:ENSOPRT00000012933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLSLLLLLPWCPGVPGQRPLNDFQVLRGTELRYLLHTVEPRSWQEDVADAEECAGRCQ
PLLDCRAFHYNVSSHGCQLLPWTQNSPNTQLQPSGRCDLFQKKDYVRTCIVANGVSYRGT
VAVTVGGLPCQAWNHRFPNDHKYTPTLRNGLEENFCRNPDRDPGGPWCYTTDPAERFQTC
GIKSCQEATCVWCNGEDYRGAVDHTESGRECQRWDLQHPHPHPFEPGKFLDQGLDDNYCR
NPDGSERPWCYTTDPKVEREFCDLPRCSTDVQPRSQTTTLFWFRGKGEDYRGTANTTAAG
VPCQRWDAQSPHQHRFAPEKYACKDLRENFCRNPDGAEAPWCFTSRQGMRVAFCYQIPRC
TDDVGPEDCYHGTGEQYRGRVSKTRKGIPCQHWSAETPHKPQFTPTSAPQASLEENFCRN
PDGDSHGPWCYTTDPGTPFDYCALRRCDDDVPPSILDPPDQVLFEKCGKRVDRQDRRRFR
LRVVGGQPGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTARQCFSSCHMPLVGYEVWLGTM
FQNPEPGEPGLQRVPVAKMVCGPSDSQLVLLKLERSVTLNQRVALICLPPEQYVVPPKTK
CEIAGWGETKGTGDDAVLNVASLNVISNQECNVKHRGRVRESEMCTDGLLAPVGACEGDY
GGPLACFTHDCWVLEGIIIPNRVCARARWPAVFTRVSVFVDWIHKVMRMD
Download sequence
Identical sequences ENSOPRP00000011810 ENSOPRP00000011810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]