SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011885 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011885
Domain Number 1 Region: 633-783
Classification Level Classification E-value
Superfamily C-type lectin-like 4.22e-28
Family C-type lectin domain 0.00078
Further Details:      
 
Domain Number 2 Region: 490-625
Classification Level Classification E-value
Superfamily C-type lectin-like 1.06e-27
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 3 Region: 800-905
Classification Level Classification E-value
Superfamily C-type lectin-like 3.54e-27
Family C-type lectin domain 0.00067
Further Details:      
 
Domain Number 4 Region: 1095-1217
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-24
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 5 Region: 13-97
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.42e-20
Family Cysteine rich domain 0.0053
Further Details:      
 
Domain Number 6 Region: 144-202
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-20
Family Fibronectin type II module 0.00087
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000011885
Domain Number - Region: 199-243
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0027
Family C-type lectin domain 0.015
Further Details:      
 
Domain Number - Region: 458-478
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00297
Family C-type lectin domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011885   Gene: ENSOPRG00000012996   Transcript: ENSOPRT00000013021
Sequence length 1250
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2803:150884:217201:1 gene:ENSOPRG00000012996 transcript:ENSOPRT00000013021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGRPGTAAVPLEPDVFLIFSHGLQGCLEALGAQVQITPACNASLPAQRWKWVSRNRLFNL
GTTQCLGTGWPGTNTTASLGMYECDREALNLRWHCRTLGDQLSLLLGGRPSNASKAGSRE
RGDQMRRGECCSYDKEEDLCAGPYFEVYTIQGNSHGKPCTIPFKYDSQWFHGCTSTGRED
GHLWCATTQDYGKDERWGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQ
QGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGRWNDSPCNQSLPSICKKAG
QLSQGTADEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTEHGSQLVTITNXXXXXXX
XXXXYSWEGEYFWTALQDLNSTGSFCWLSGDEVMYTHWNRDQPGFSRGGCVALATGSAMG
LWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGPCPRGWGSGPKLRFCYKVFSS
ERPQNKKSWVQAQSACHELGAQLLSLGSYEEEHFVANMLNKIFGESEPEIHEQHLFWIGL
NRRDPAGGQSWRWSDGLGFSYHNFDRSRHDDDDIRGCAVLDLASLQWVAMQCETQLDWVC
KIPRGVDIREPDGRPQGRREWQRFQEAEYRFFEHHSTWVQAQRVCTWFQAELASVHSQAE
LDFLGHNLQKFALGQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCV
YMTASRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSGWNQFLNKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXPSLSPSPAATPPAPGTDLSYLNGTFRLLQKPLRWHDALLLCESRNASLARVFDPYT
QAFLTQAAHGLRTPLWIGLASEEGSRRYSWVSEEPLSFASWQDGEPQQPGGCAYVDVDGA
WRTASCDTKLQGAVCGVGGGPSPLRRFSYQGSCPQGLADSAWIPFREHCY
Download sequence
Identical sequences ENSOPRP00000011885 ENSOPRP00000011885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]