SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012026 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012026
Domain Number 1 Region: 5-144
Classification Level Classification E-value
Superfamily Thiolase-like 5.44e-38
Family Thiolase-related 0.001
Further Details:      
 
Domain Number 2 Region: 230-355,418-457
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.28e-32
Family FabD-like 0.0083
Further Details:      
 
Domain Number 3 Region: 1621-1807
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.76e-29
Family Tyrosine-dependent oxidoreductases 0.0002
Further Details:      
 
Domain Number 4 Region: 1961-2039
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.15e-19
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.0000167
Further Details:      
 
Domain Number 5 Region: 968-1143
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000297
Family UbiE/COQ5-like 0.054
Further Details:      
 
Domain Number 6 Region: 1862-1925
Classification Level Classification E-value
Superfamily ACP-like 0.0000000000236
Family Acyl-carrier protein (ACP) 0.00013
Further Details:      
 
Domain Number 7 Region: 355-411
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000000275
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012026   Gene: ENSOPRG00000013152   Transcript: ENSOPRT00000013176
Sequence length 2039
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3926:3462:17384:-1 gene:ENSOPRG00000013152 transcript:ENSOPRT00000013176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTFLGEAQEQLIRSLYEPAGLAPESLEYIEAHGTGTKVGDPQELNGIVRALCASRKDPLL
IGSTKSNMGHPEPASGLTSLAKVLLCLEHELWAPNLHFHNPNPEVPALSDGRLQVVDRPL
PVRGGNVGINSFGFGGSNVHVVLQPNTRPPGPAPHAALPRLLRASGRTPEAVQNLLEQGQ
RHSQDLTFVSMLNDIAPTSPAAMPFRGYSVLGGEASSQDVQQVPAGKRPLWFICSGMGTQ
WHGMGRSLMRLDRFRASILRSDQTLAPFGVKVSGLLLSPEEGVFDDIVYAFVSLTAIQIA
LIDLLTAVGLQPDGIIGHSLGEVACGYADGCLSQEEAVLAAYWRGQCIKDAHLPSGAMAA
VSLSWEECKQRCPPGIVPACHNSVDTVTISGPQAPMAEFVEQLRREGVFAKEVRTGGLAF
HSYFMDAIAPTLLEQLKKVIREPRPRSARWLSTSIPEAEWQGSLARXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXRITALHIDPATHLRKVHSWGEAQAADAVVDSCLGTLVSGGAHLAGLHTSTAP
RRQQEQLVPILEKFCFVPHVEGSCLAENAALQEELQLCKGLAQVLQTRVAQQGLKMAVPG
LDGARVPVPQEPPQQVLPRLLAAACQLQLNGSLQQALGHALAQERSLLPEDPLLSGLLTC
PALKVCVDTALENLASPRMKVVEVLAGEGHLFTRIPDLLNSQPLLQLDYTATDRHSQALE
AAHAQLQQWGIGQSQWDPEGPAPSSLGAVDLLVCNCTVANLGDPASALGNMAAALKEGGF
LLLHALLRGHTLGETLAFLAAAEPQQGPSLLTQDEWEQLMAKAALQLVAVKASCYGSVLF
LCRRPAPRHSPVFLPVDDATFRWVDPLKDILAEDSPRPVWLTAMSCPTSGVVGLVNCLRK
EPGGHRIRCMLLSSLSGESRVPALGPGSPELEDVLRTDLVMDVYRDAWGAFRHLQLEQXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
HKTYVLVGGLGGFGLLAGWLVLRGAQRLVLTSRSGIRTGYQAKQVREWRRQGVQVLVSTR
DASSLEGARALVAEAAQLGPVGGIFNLAMVLRDGMLENQSPALFLDVSRPKYHGTMNLDR
VTREACPELDYFVVFSSVSCGRGNSGQSNYGFANSCMERVCEQRRQDGLPGLAVQWGAVG
DVGVVLETMGTNDTVIGGTLPQRIASCLEVLELFLHQPHAVLSSFVLAEKKAAARGDGDG
QQDLVKAVAHILGIRDLAGISMDSSLADLGLDSLMGVEVRQTLERQHDLVLSMREVRQLT
LRRLQELSSKASADTELPSATSKEGSPAREQQLNLSTLLVNPEGPTLTRLNSVQSSERPL
FLVHPIEGSTTVFHSLAARLSVPTYGLQCTRAAALDSIQSLAAYYIECIRQVQPEGPYR
Download sequence
Identical sequences ENSOPRP00000012026 ENSOPRP00000012026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]