SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012380 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012380
Domain Number 1 Region: 7-486
Classification Level Classification E-value
Superfamily ALDH-like 4.45e-146
Family ALDH-like 0.0000000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012380   Gene: ENSOPRG00000013580   Transcript: ENSOPRT00000013568
Sequence length 487
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1502:98660:121478:-1 gene:ENSOPRG00000013580 transcript:ENSOPRT00000013568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPKMDVPLVLENFIGGTFSPCKSYLDSYDPSTGEVYCHVPNSGKEEVEAAVEAARQAFPD
WAARSPQERAQVLNKVADLLEQSLEELAQAESKDQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXGLISPWNLPLYLLTWKLAPALAAGNAVIAKPS
ELTSVTAWMLCKLLNKAGVPPGVVNIVFGTGPRVGEALVSHPEVPVISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAVIFEDANLEQCIPETIRSSFVNQGEVCLCTSRIFVQRSIY
NEFLRRFVEAARRWKVGVPSDPSAKMGALISKAHLEKVRSYINKARAEGAQILCGEGVDT
LSLPLRNQAGYFMLPTVITGIKDESCCMKEEIFGPVTCVVPFESEEEVIQRANSVKYGLA
AMVWSRDVGRIHRVAKRLQAGLVWTNCWLIRELNLPFGGMKSSGVGREGAKDSYEFFTEI
KTITVKH
Download sequence
Identical sequences ENSOPRP00000012380 ENSOPRP00000012380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]