SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012666 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012666
Domain Number 1 Region: 328-385
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000113
Family PHD domain 0.0024
Further Details:      
 
Domain Number 2 Region: 271-332
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000106
Family PHD domain 0.013
Further Details:      
 
Domain Number 3 Region: 885-927
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000153
Family PHD domain 0.026
Further Details:      
 
Domain Number 4 Region: 401-460
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000186
Family PHD domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000012666
Domain Number - Region: 4556-4585
Classification Level Classification E-value
Superfamily SET domain 0.000248
Family Histone lysine methyltransferases 0.084
Further Details:      
 
Domain Number - Region: 1994-2023
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 0.033
Family 4'-Phosphopantetheinyl transferase SFP 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012666   Gene: ENSOPRG00000013818   Transcript: ENSOPRT00000013883
Sequence length 4585
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_222:3822:280396:-1 gene:ENSOPRG00000013818 transcript:ENSOPRT00000013883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRSRGKTAVEDEDSMDGLETTETETIVETENKDQSAEEDAEEVDNNKQLVPVLQRSVSED
SAHSLVSVGVEANISEQLCAFCYCGEKSSLGQGDLKQFRVTPGLLLPWKSQPSNQKDPDD
SSNGACERMPRKQRGQRKERSPLPNIVSCVSVSTQTSSDDQAGKLWDELSLVGLPDAVDI
QALFDPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRCAFCKHLGATIKCCE
ENCTQMYHYPCAAGAGTFQDFRHFFLLCPEHIDQAPQRSKEDANCAVCDSPGDLLDQFFC
TTCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQ
PVMKSVPTNGWKCKNCRICVECGTRSSSQWHHNCLICDSCYQQQENLCPFCGKWYHPELQ
KDMLHCHLCGRWVHLECDKPTDNELDSQLIEEYVCMYCKHLEAEMEPLHPGGEVEMAELN
TDYSNEMEVEGPEDQIVFLKQTENKGVDGDESTPGIVPAAVQIHTEEQQNQVPEILDNNG
HLFSESPQNKENIELENQISHEVDKENWEMPSKVINICDEDQSGKMEVTENVDVLTHQMV
VQQEELQVLEEPKTEVSKEEPGSPKAVVKAITVALVSPSEESTLLSCNEHLVTERVQEGK
EQKESELSCRSTNFEMTPAVHSCMKDGSCRGDKSVSSEALSSFSSSGDLSKAVVSSSPAL
CSDLPPQNILHNFPSTLSSPVGNIMPTTYISVTPKIGMGKPAISKRKFSPGRPRSKQGAW
STHNTVSPPSWSPDISEGRDTFKPRQLPGSAIWSLKVGRGSGFPGKRRPRGAGLSGRGGR
GRSKLKSGIGAVVLPGVSTADISSNKDEEENSMHNTVVLFSSGDKFTLHQDMCVVCGSFG
QGAEGRLLACSQCGQCYHPYCVSIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXWMHAVCQNLNTEEEVENVADIGFDCSMCRPYMPVSNVPS
SDCCESSLVAQIVTKVKELDPPKTYTQDGVCLTESGMTQLQSLTVTVPRRKRSKPKLKLK
IINQNSVAVLQTPPEIQSEHSRDGEMDDSREGDLMDCDGKSESSPEREPVDDEAKGVDGP
DAIKKRKRKPYRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWSEQLP
DTLVDESVSVSESSDKIKKRYRKRKNKLEETFPVYLQEAFFGKDLLDTSRQSKLSLDSLS
EDAVQLSYKTNVNTSFLEASLDPVLSSSSVPAKLGSQXXXXXXXXDISEVLNTDDDILGI
ISDDLAKSVDHSDVGPVADDPSALSHPSVSQNSRPLSEEQLDGILSPELDKMVTDGAILK
VYKIPELGGKDVEDLFTAVLSPATTQPTPLPQPPPPTQLLPMHNQDVFSRMPLMNGLIGP
NPHLPHHSLPPGSGMGTFSSIAQSPYTDIRDKNPAFNSLPSDPNSPWTSSAPTMEAENDT
MSNAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEFPXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXQMRQKSKQQAKIETQKLEQVKNEQQQQQQQQFGPQHPLVPSGSDTPSSGVQSP
LTPQPSNGNMSPAQSFHKELFTKQLPSTPTSTSSDDVFVKPQAPPPPPTPSRIPIQENLS
QPQASQPPSPQVFSPGTSNSRPPSPVDPYAKMVGTPRPPPVGHSFPRRNSVPPVENCAPL
SSVSRPMQVNETTTNRPSPVRDLSSSSTTNSDPYAKPPDTPRPVIDQFPKPLGLPRSPIV
SDQTAKGPPAIGTNDHFTKPSPRSDVFQRQRVPDPYARALLAPAPLDGSPGTFKTPVQPP
PSSHDPYGSASQASRRLSADPYDRPTLTPRPGDHFSHSHSNDLYSQSPLTPHPALNESFA
HSSRAFPQPGTISRPASQDRQKLREMILQQQQQKKIASRQEKGPQDAAAAPPGPLQHWQR
DSITQTFSRPPPPYPGNMRAPGVPSLGPRYSVFPKDQRGPFPPDIAGMRMRPHGFRFGFP
GGSHGTMSSQERFLVPPQQLQGPGVLPQLRRSVSVDMPRALNNSSMNNPIGLPQHFPPQS
LPVQQHNILGQAFIELRHRAPDGRPHVPFSASGSVTEPPSHLRPGNFIPRPDFPGPRYTD
SIRQPPQGLPNALPVHPNLEPVPPSQQEQGQPAHPPSLAVRPPSHPLVGEFSETPLSTSA
PVEAASDSLQITSQPADGLEEKLDSDDPSVKELDVKDLEGVEVKDLDDEDLENLNLDTED
GKGDELDTLDNLETNDPNLDDLLRSGEFDIIAYTDPELDLGDKKSMFNEELDLSVPIDDK
LDNQCVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXEQPLLLQDLLDQERQEQQQQRQMQAMIRQRSEPFF
PNIDFDAITDPIMKAKMVALKGINKVMAQNSLGMPPMVMSRFPFMGPSVAGTQNSEGQSL
VPQSITQXXXXXXXXXXXXXXXXXXXXXXDSQRKQYEEWLQETQQLLQMQQKYLEEQIGA
HRKSKKALSAKQRTAKKAGREFPEEDAEQLKHVTEQQSMVQKQLEQIRKQQKEHAELIED
YRIKQQQQQQQCAVAPPAIMPGVQPQTPLVPGATPPTMSQPNFPLLPQQLQHQQHAAVIS
GHSSPARMPSLPGWQPTNSPAHLPLNPPRIQPPIAQIPIKTCTPAPGTVANANAQSGAPP
RVEFDDNNPFSESFQERERKERLREQQERQRIQLMQEVDRQRALQQRMEMEQHGMMGSEL
NCRTTVSQIPFYSSDLPCDFRQPPRPLQQSPQHQQQMGQVLQRQNMQQGSINSPPTPTFL
QTSERRQGAPPSFIPDSPPVPGGSPNFHSVKQGHGSLSGTNFQQSPVRPPFTPSLVAAPP
PIANSSLPCSQDPAVTHGQNFPGTAQSLIQLYSDIIPEEKGKKKRARKKKKDDDAESSKA
PSTPHSDITAPSTPGVSETTSTPPGSTPRELPESVEPVGPSAPSVVASQPDSELESRLLP
SDFSQGPPDQQTYANSEVNKLPMETPAKTEDVKLEKAEVELCPGQEELKLEEQTGIQIEE
KAVAAPSVSSAQSPPPALGAPSAKGDAGNELLKHLLKNKKAASLLNQKPEGSFCSEDNCT
KDTKMIEKQNVTEGLQTLGAQMQSGFGCGNNQLPKTDGGNENKKQRSKRTQRAGEKAAPR
SKKRKREGEEKPAVYSSSDSFTHLKQQNNLSNPPTPPASLPPTPPPMACQKMANGFATTE
ELAGKAGMLVSHEVTKTLGPKPFQLPFRSQDDLARAIAHGPKTVDVPASLPTPPHNNQEE
LRIHDHCADRDSPDSFVPSSSPESVVGAEVSRYPDLSLVKEEPPEPVPSPIIPILPSTAG
KGSESRRNDIKTEPGTLFFTSFGSSSNGPRSGLISVAITLHPSAAENISSVVAAFSDLLH
VRIPNSYEVSNAPDVPPMGLVNSHRVNPGLEYRQHLLLRGPPPGSAHPPRLASPYRLKQP
NAPFPPTSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSFQSTVTGELSAPYSKQFVHSKSSQYRKMK
TEWKSNVYLARSRIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLCYDY
KFDFEDDQHKIPCHCGAVNCRKWMN
Download sequence
Identical sequences ENSOPRP00000012666 ENSOPRP00000012666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]