SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012861 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012861
Domain Number 1 Region: 9-120
Classification Level Classification E-value
Superfamily Histone-fold 5.97e-45
Family Nucleosome core histones 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012861   Gene: ENSOPRG00000014102   Transcript: ENSOPRT00000014093
Sequence length 120
Comment pep:novel genescaffold:pika:GeneScaffold_1253:138494:140015:-1 gene:ENSOPRG00000014102 transcript:ENSOPRT00000014093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPLPSKSAPSPRKGSKKAITKAQYKQGRECKRSRKSYVYYSAQQVHDGISSKAMGIMNSF
VNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Download sequence
Identical sequences ENSOPRP00000012861 ENSOPRP00000012861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]