SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012862 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012862
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.00000000955
Family LysM domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012862   Gene: ENSOPRG00000014112   Transcript: ENSOPRT00000014094
Sequence length 180
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2641:182590:185582:-1 gene:ENSOPRG00000014112 transcript:ENSOPRT00000014094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSRQPPLGGSGLLQGSRARSYGSLVQSACSPVRERRLEHLLQPGDTLAGLALKYGVT
MEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFSGLDSEEEKDGEEDGCPSKDDAWPHS
TERKKRETSTGHANGDVPPTARQELATPTQDLSASDFLKKLDSQISLSKKAAAQKLKRES
Download sequence
Identical sequences ENSOPRP00000012862 ENSOPRP00000012862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]