SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013097 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013097
Domain Number 1 Region: 373-627
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.07e-76
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 83-133
Classification Level Classification E-value
Superfamily Kringle-like 4.57e-16
Family Fibronectin type II module 0.0021
Further Details:      
 
Domain Number 3 Region: 222-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000699
Family EGF-type module 0.03
Further Details:      
 
Domain Number 4 Region: 143-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 5 Region: 180-219
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000889
Family Fibronectin type I module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013097   Gene: ENSOPRG00000014329   Transcript: ENSOPRT00000014352
Sequence length 637
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3306:1514:6700:1 gene:ENSOPRG00000014329 transcript:ENSOPRT00000014352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCWAWVPIPDPPPRLSLLLLLLLPLLLGGSQPQAGRNYTEPPEPGTTATLETPVSPMTSA
TLAIPATRAPEPVGPQGGGVLQVLTEAGQPCRFPFRYGGRMLHMCTTAGGAHRKWCATTH
NYDRDRAWGYCVEAQPEGPAAPDPCASSPFRNGGSCAPSQDPAAYHCTCPSAFTGTDCGT
ERCFDETRHEYLPLGERWARVRQGRVEQCDCRGGGARCQNAPHTVCQSSPCLNGGTCHLI
VATGTTVCACPPGYAGRLCNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLARIQPPVSEA
LVPLAEPVAAARTTCVRRHKKRSFLRPRIVGGSSALPGSHPWLAAVYIGNSFCSGSLVHT
CWVVSAAHCFASSPSQESVTVVLGQHFFNQTTDVTQVFAIEKYVPYPLYSVFNPSDHDLV
LIRLKKKGERCAVRSQFVQPICLPEPGSTFPAGHKCQISGWGHVDENSSGHSSVLREALV
PLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLVCDKDGVAYLYGIISGG
DGCGRLNKPGVYTRVANYVDWITDRIRPSRRLVAPSW
Download sequence
Identical sequences ENSOPRP00000013097 ENSOPRP00000013097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]