SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013128 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013128
Domain Number 1 Region: 4-204
Classification Level Classification E-value
Superfamily Heme oxygenase-like 2.23e-67
Family Eukaryotic type heme oxygenase 0.0000000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013128   Gene: ENSOPRG00000014394   Transcript: ENSOPRT00000014384
Sequence length 204
Comment pep:novel genescaffold:pika:GeneScaffold_731:8672:12423:1 gene:ENSOPRG00000014394 transcript:ENSOPRT00000014384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQDLSEALKEATKEVHTQAENAEFMKNFQKGQVTAEGFKLVMASLYHIYVALEEEIEHN
KENPVYTPLYFPEELHRKAALELDMAFWYGPRWQETIPCTPATQRYVRRLQQVGRTEPEL
LVAHAYTRYLGDLSGGQVLKKIAQKALDLPASGECVAFFTFPHIASATKFKQLYRSRMNS
LEMTPGVRQRVVEEAKTAFLLNIQ
Download sequence
Identical sequences ENSOPRP00000013128 ENSOPRP00000013128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]