SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013158 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000013158
Domain Number - Region: 248-424
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0011
Family Quinoprotein alcohol dehydrogenase-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013158   Gene: ENSOPRG00000014424   Transcript: ENSOPRT00000014415
Sequence length 433
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1832:9425:13939:-1 gene:ENSOPRG00000014424 transcript:ENSOPRT00000014415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLFQSPEEGWQLYTSAQAPDGKCICTAVIPAQGTCSRDGRSRELRQLMDKXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXVWYMDGYYKGRRVLEFRTLGDFIKGQNFIQHL
LPQPWAGTGHVVYNGSLFYNKYQSNVVVKYHFRSRSVLVQRSLPGAGYNNTFPYSWGGFS
DMDFMVDESGLWAVYTTNQNAGNIVVSRLDPHTLEVLRSWDTGYPKRSAGEAFMICGVLY
VTNSHLAGAKVYFAYFTNTSSYEYTDVPFHNQYSHISMLDYNPRERALYTWNNGHQVLYN
VTLFHVISTAGDP
Download sequence
Identical sequences ENSOPRP00000013158 ENSOPRP00000013158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]