SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013209 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013209
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily UBC-like 6.25e-43
Family UEV domain 0.000000159
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000013209
Domain Number - Region: 362-383
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0177
Family VPS23 C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013209   Gene: ENSOPRG00000014461   Transcript: ENSOPRT00000014468
Sequence length 390
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_420:4103:108672:-1 gene:ENSOPRG00000014461 transcript:ENSOPRT00000014468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSESQLKKMVSKYKYRDLTVRETANVINLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGEEPPVFSRPAASASYPPYQATGPPNXXXXXXXXXXISAIPGYPP
NPSGYPGCPYPAGGPYPATTSSQYPSQPPVTTVXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAEVDKNIELLKKKDEELSS
ALEKMENQSENNDIDEVIIPTAPLYKQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XHVRLLSRKQFQLRALMQKARKTAGLSDLY
Download sequence
Identical sequences ENSOPRP00000013209 ENSOPRP00000013209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]