SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013226 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013226
Domain Number 1 Region: 14-69
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000667
Family HLH, helix-loop-helix DNA-binding domain 0.0091
Further Details:      
 
Domain Number 2 Region: 240-276
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000274
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000013226
Domain Number - Region: 93-121
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00977
Family BphP N-terminal domain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013226   Gene: ENSOPRG00000014480   Transcript: ENSOPRT00000014488
Sequence length 669
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1717:4315:112119:1 gene:ENSOPRG00000014480 transcript:ENSOPRT00000014488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGLQRARSSTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLT
ISYLRMHRLCAAGEWSQPGVEGEPLDACYLKALEGFVMVLTAEGDMAYLSENVTKHLGLS
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVLHCSGHMRAYRPPAQTSPTGSPRSEPPLQCLVLICEAIPHPGSLEPPLARGS
FLSRHSLDMKFTYCDERIAEVAGYSPDDLIGCSAYXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVEETGVVLSLEQTERNS
RRPHQRSIPSQTDGPASGDRHDPGPRVLAFLHPPALSEAALAADPRRFCSPDLRRLLAPI
LDRASVAAATPSTRPAGRRPLSPVLXXXPDQMLVGMENTHKSVVTQKTLEAKETELEVAQ
DANGLDLEMLAPYISMDDDFQLSSCDQLPRAYHKPAGTVPRPRARSFHGLSPPTPEASVL
PRWGSDPRLSCSSPCRRDASMSSPVPRAQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGPSLLSHYPVEDATPSRSLFQ
PAAGSARAH
Download sequence
Identical sequences ENSOPRP00000013226 ENSOPRP00000013226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]