SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013246 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013246
Domain Number 1 Region: 513-695
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.93e-45
Family Hemopexin-like domain 0.0000000922
Further Details:      
 
Domain Number 2 Region: 113-212,386-443
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.48e-41
Family Matrix metalloproteases, catalytic domain 0.000000634
Further Details:      
 
Domain Number 3 Region: 335-389
Classification Level Classification E-value
Superfamily Kringle-like 1.08e-21
Family Fibronectin type II module 0.00014
Further Details:      
 
Domain Number 4 Region: 273-330
Classification Level Classification E-value
Superfamily Kringle-like 1.26e-20
Family Fibronectin type II module 0.0001
Further Details:      
 
Domain Number 5 Region: 217-272
Classification Level Classification E-value
Superfamily Kringle-like 2e-20
Family Fibronectin type II module 0.00018
Further Details:      
 
Domain Number 6 Region: 30-103
Classification Level Classification E-value
Superfamily PGBD-like 1.15e-18
Family MMP N-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013246   Gene: ENSOPRG00000014506   Transcript: ENSOPRT00000014513
Sequence length 696
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1699:220027:231016:1 gene:ENSOPRG00000014506 transcript:ENSOPRT00000014513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPRQPVVLALLALGCCFAAPRRQPTVVVFPGELRSSLTDRQLAEEYLYRYGYTKAAGIH
RGNQAFPAALLRLQKQLALPQTGELDSATLDAMRAPRCGVPDVGRFQTFEGDLKWHHHNI
TYWIQNYSEDLPRNVIDDAFARAFALWSAVTPLSFTRVYSRDADIVIQFGVAEHGDGYPF
DGKDGLLAHAFPPGPGIQGDAHFDDEELWTLGKGVVVPTYFGNADGAPCHFPFTFQDRSY
TTCTADGRSDGMLWCSTTANYDSDRRFGFCPSERLYTQDGNADGKPCHFPFTFQGRSYSA
CTTDGRSDGYRWCATTASYDQDKLYGFCPTRADSTVIGGNSAGDLCVFPFVFLGKEYSSC
TSEGRKDGRLWCATTSNFDSDKKWGFCPDRGYSLFLVAAHEFGHALGLDHSTVPEALMYP
MYRYLEGSPLHEDDVDGIQKLYGPNPDPQPRPPATTTPQPTAPPTICPTGPPTVRPSEPP
TTSPTGAPSAGPTGPPTAGPSAVPTAPWDPADDVCEVDIFDAIAEIGNQLLVFKDGRYWK
FSEGRGRQSQGPFLITDTWPALPAKLDAAFEEPLTKKLFFFSGRQVWVYSGASVLGPRRL
DKLGLGREVTQVTGVLPRSGGKALLFSGQRFWRFDVTQKVDPRRAMPVEEMFHLSLYKKA
YFCQDRFFWRVSARSEVNKVDQVGYVNFDILHCPED
Download sequence
Identical sequences ENSOPRP00000013246 ENSOPRP00000013246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]