SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013394 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013394
Domain Number 1 Region: 77-517
Classification Level Classification E-value
Superfamily ALDH-like 2.49e-169
Family ALDH-like 0.000000000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013394   Gene: ENSOPRG00000014667   Transcript: ENSOPRT00000014672
Sequence length 522
Comment pep:novel genescaffold:pika:GeneScaffold_1199:191071:219179:1 gene:ENSOPRG00000014667 transcript:ENSOPRT00000014672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHAAALAATAGLRPLLGRRLLSAAAAQAVPAPNQQPEIFYNKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXADVDRAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERD
RTYLAALETLDNGKPYIISYLVDLDLVLKCLRYYAGWADKYHGKTLPIDGDFFSYTRHEP
VGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVV
NIVPGYGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIM
SDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYNEFVERSVARAKSRVVGNPFDSR
TEQGPQVDETQFKKILGYIKSGKQEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKE
EIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDV
FGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Download sequence
Identical sequences ENSOPRP00000013394 ENSOPRP00000013394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]