SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013679 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013679
Domain Number 1 Region: 92-272
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.3e-64
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000334
Further Details:      
 
Domain Number 2 Region: 267-297
Classification Level Classification E-value
Superfamily E set domains 0.00000000653
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013679   Gene: ENSOPRG00000014981   Transcript: ENSOPRT00000014980
Sequence length 297
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_938:569:17196:1 gene:ENSOPRG00000014981 transcript:ENSOPRT00000014980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNDLSSLSLAVHRSSXXXEIIDEYIKKNGFCLESPQNLNERSICMLSRGSTTLSTVTLGA
PVPPATPPPPPPPWGCHLGRLLPHTPGPGPRPHLVITEQPKQRGMRFRYECEGRSAGSIL
GESSTEASKTLPAIELRDCAGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCRVRLR
PHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQAS
YRDQQGQLRHMEPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQK
Download sequence
Identical sequences ENSOPRP00000013679 ENSOPRP00000013679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]