SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013714 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013714
Domain Number 1 Region: 9-189
Classification Level Classification E-value
Superfamily ITPase-like 5.89e-39
Family ITPase (Ham1) 0.000000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013714   Gene: ENSOPRG00000015022   Transcript: ENSOPRT00000015018
Sequence length 191
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2053:179002:188698:1 gene:ENSOPRG00000015022 transcript:ENSOPRT00000015018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLVGKKIVFVTGNAKKLEEVIQILGDTFPCTLEARKIDLPEYQGEPDEISIQKCREA
ARQXXXXXXXXXXXXXXXXXXXXXXXXXKWFLGKLKPEGLHQLLAGFEDKSAYALCTFAL
STGDPSEPVQLFRGRTPGRIVEPRGSRDFGWDPCFQPDGYEQTYAEMPKAEKNVISHRYR
ALRALQDYLAA
Download sequence
Identical sequences ENSOPRP00000013714 ENSOPRP00000013714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]