SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013715 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013715
Domain Number 1 Region: 138-388
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.76e-72
Family Extended AAA-ATPase domain 0.00000164
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000013715
Domain Number - Region: 39-68
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.000811
Family RILP dimerisation region 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013715   Gene: ENSOPRG00000015023   Transcript: ENSOPRT00000015019
Sequence length 405
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4007:383160:388546:1 gene:ENSOPRG00000015023 transcript:ENSOPRT00000015019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDGPEMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLRE
ELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSY
TLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIA
QPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREH
APSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDIL
DSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKG
VCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
Download sequence
Identical sequences ENSOPRP00000013715 ENSOPRP00000013715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]