SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013751 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013751
Domain Number 1 Region: 1067-1112
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000353
Family Nuclear receptor coactivator interlocking domain 0.00052
Further Details:      
 
Domain Number 2 Region: 266-370
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000495
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.0006
Further Details:      
 
Domain Number 3 Region: 121-171
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000852
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.029
Further Details:      
 
Domain Number 4 Region: 36-90
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000916
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013751   Gene: ENSOPRG00000015038   Transcript: ENSOPRT00000015059
Sequence length 1459
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2504:54265:141374:-1 gene:ENSOPRG00000015038 transcript:ENSOPRT00000015059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGMGENTSDPSRAETRKRKECPDQLGPSLKRSVEKRNEQENKYIEELAELIANFNDIDN
FNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMMLEA
LDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVRNLLPKSIXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXLQSCLICVARRVPMKERPILPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLVRR
CIQKFHAQHEGESISYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQTTN
EPQLVISLHMLHREQNVCVMNPDLTGQAMGKPLNPISSSSPAHQAMCSGNPGQDMTLSSN
MNFPINGPKEPMGMSLGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPAQP
ASMLSPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQALSE
GHGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQAES
SCHPGEQKDASDSGMAQAVSSDRADGQSRLHDSKGQTKLLQLLTTKSDQMEPSPLSSSLS
DTNKDSTGSLPGSGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKELSQESSGT
APGSEVTIKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPTSHTKLI
AMKAEKEELSFEPSDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAIIND
LMQLTAENSPVTPVGSQKSALRISQSTFNNPRPGQLGRLLPNQNVPLDITLQSPTGAGPF
PPIRNSSPYSVIPQPGMMGNQGMIGNQGNLGSSSTGMIGNNASRPTMPSGEWAPQSAAVR
VTCAATTSAMNRPNQGGMIRNPTASIPMRPSSQPGQRQMLQSQVMNIGPSELEMNMGGPQ
YSQQQAPPNQTAPWPESILPIDQASFANQNRQPFGSSPDDLLCPHPAAESPSDEGALLDQ
LYLALRNFDGLEEIDRALGIPELVSQSQAVDPEQFSNQDSNIMLEQKAPVFPQQYASQAQ
MAQGSYTPMQDPNFHTMGQRPSYATLRMQPRPGLRPTGLVQNQPNQLRLQLQHRLQAQQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISQQPDAGFAGATAPQ
SPLMSPRMAHTQSPMLQQSQANPAYQAPSDMNGWAQGSMGGNSMFSQQSPPHFGQQANTS
IYNNNMNISVSMATNTGGMSNMNQMTGQISMTSVTSVPTSGLSSLGPEQVNDPALRGGNL
FPNQLPGMEMIKQEGDASR
Download sequence
Identical sequences ENSOPRP00000013751 ENSOPRP00000013751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]