SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013760 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013760
Domain Number 1 Region: 44-186
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.94e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.0000475
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000013760
Domain Number - Region: 4-40
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000907
Family Glutathione S-transferase (GST), N-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013760   Gene: ENSOPRG00000015080   Transcript: ENSOPRT00000015068
Sequence length 188
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2866:12552:13371:-1 gene:ENSOPRG00000015080 transcript:ENSOPRT00000015068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLDVLKDFAPGSQLPILLYDGEAKTDTLQIEEFLEQTLGPPNFPSLAPRYRESNTAGNDV
FHKFSAFIKNPAPAQDQALYQQLLRALARLDGYLRAPLEHELAREPQLRESSRRFLDGDQ
LTLADCRLLPKLHIVDAVCAHFRHAPIPAELRAVRRYLDNAQQEKEFKYTCPPGADILAA
YRPVVRPR
Download sequence
Identical sequences ENSOPRP00000013760 ENSOPRP00000013760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]