SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013962 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013962
Domain Number 1 Region: 562-705
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.01e-44
Family Eukaryotic proteases 0.0000012
Further Details:      
 
Domain Number 2 Region: 364-457
Classification Level Classification E-value
Superfamily Kringle-like 7.49e-36
Family Kringle modules 0.0000303
Further Details:      
 
Domain Number 3 Region: 184-267
Classification Level Classification E-value
Superfamily Kringle-like 9.67e-35
Family Kringle modules 0.00000942
Further Details:      
 
Domain Number 4 Region: 469-562
Classification Level Classification E-value
Superfamily Kringle-like 1.21e-32
Family Kringle modules 0.0000142
Further Details:      
 
Domain Number 5 Region: 19-97
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 9.42e-19
Family Hairpin loop containing domain 0.026
Further Details:      
 
Domain Number 6 Region: 135-182
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-18
Family Kringle modules 0.00043
Further Details:      
 
Domain Number 7 Region: 272-317
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000184
Family Kringle modules 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013962   Gene: ENSOPRG00000015274   Transcript: ENSOPRT00000015283
Sequence length 706
Comment pep:novel genescaffold:pika:GeneScaffold_1627:8128:128593:1 gene:ENSOPRG00000015274 transcript:ENSOPRT00000015283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHKEVSLLLLLFLKAGQGQSLDGYVNTQGASLLSVTRKQLEAASIEDCAAKCEAETEFV
CRSFQYHSKEPQCVVMPENRKSSLILRRRDVVLYEKEXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXFVPEEYPAEGLEKNYCRNPDNDVEGPWCYTTDPNKRYDYCDIPE
CEVECMHCSGENYAGKISRTMSGIECQAWDSQTPHAHGYVPSKFPNKNLKNNYCRNPDGE
PRPWCFTTDPKKRWELCDIPRCETPPPTSGPTHQCLKGKGESYRGTVAVTKSGFTCQRWS
EQTPHRHNRTPENFPCXXXXXXXXXXXXXXXXXXXXXXXXXXXWDYCDIPSCDSSPVTDS
VDSTEPPEQTPVVQECFQGNGQSYRGTSSTTVTGRKCQSWTSMKPHKHEKTPETPDAGLT
MNYCRNPDGDSRPWCYTTDPRVRWEYCNLQRCSETVPGPAATIPVAQPPRAEATAEPDCM
FGIGRGYRGKKATTADGTPCQGWAAQEPHKHSIFTPESNPRAALERNYCRNPDGDTNGPW
CYTMNPKKLFDYCDVPLCASSPLECGKPKVEPKKCSQRVVGGCVSYPHSWPWQISLRTRF
GQHFCGGTLIDPQWVVTAAHCLESCQEPSSYRVILGAHQEKNLEPHVQDIIVGKIFLEPS
RSDIALLKLSSPAVITNQVIPACLPSSNYMVADRTVCYITGWGETQ
Download sequence
Identical sequences ENSOPRP00000013962 ENSOPRP00000013962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]