SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014054 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014054
Domain Number 1 Region: 40-192
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 8.89e-79
Family Hedgehog (development protein), N-terminal signaling domain 0.000000259
Further Details:      
 
Domain Number 2 Region: 199-277
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.000000000000597
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014054   Gene: ENSOPRG00000015383   Transcript: ENSOPRT00000015386
Sequence length 295
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3795:81604:100662:-1 gene:ENSOPRG00000015383 transcript:ENSOPRT00000015386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPASLLPLCCLALLALPAQSCGPGRGPVGRRRYVRKQLVPLLYKQFVPNVPERTLGAS
GPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPG
VRLRVTEGWDEDGHHSLDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRN
HVHVSVKADNTQTERAGGCFPGNATVRLQSGERKGLRELHGGDWVLAHDAAGRGVPTPVL
LYLNGDQRRALSVSVETERPPRKLLLTPWQLVFAARGPAPAQGDFPPEFARRCVA
Download sequence
Identical sequences ENSOPRP00000014054 ENSOPRP00000014054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]