SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014118 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014118
Domain Number 1 Region: 1753-1962
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.08e-78
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000249
Further Details:      
 
Domain Number 2 Region: 52-315
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.14e-76
Family Carbonic anhydrase 0.0000081
Further Details:      
 
Domain Number 3 Region: 1960-2229
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.1e-66
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000283
Further Details:      
 
Domain Number 4 Region: 324-379
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000917
Family Fibronectin type III 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014118   Gene: ENSOPRG00000015427   Transcript: ENSOPRT00000015455
Sequence length 2232
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1033:37713:161163:1 gene:ENSOPRG00000015427 transcript:ENSOPRT00000015455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSRGIAAREAPERLAMTVLQRFLACVQLLCVCRLDWAYGYYRQQRKLVEEIGWSYTGALN
QKNWGKKYPMCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEVN
LTNDYRLSGGVSDTVFKASKITFHWGKCNASSDGSEHSLEGQKFPLEMQIYCFDAGRFSS
FEEAVKGKGKLRALSILFEVGMEDNLEYKTIIDGVESVSRFGKQAVLDPFILLNLLPNST
DKYYSYNGSLTSPPCTDTVEWIVFKETVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNF
REQQYKFSRQVFSSYTGKEEIHEAVCSSEPENVQADPQNYTSLLVTWERPRVVYDAMIEK
FAVLYQPLDGDQTKHEVLTDGYQDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXLDLFPELIGTEEIIKEEDEEGFIVNPGRDSTTNQIRKKEPHISTTTHYNYIG
TKSNEAKTNRSPTRGSELPGKTNIPNTSLDSTSHSETMTKLPPQTVEGTLASLNVGSKTV
AKYPQMNLTGTAESVHTVSVTEYEEEGLLTSFRHDIGSDDSSGSSPATSAMPFVSENISH
VYVFSSENPEAIPYDLLIPESTRKASEDSVSSGSEESLKDLSVDGNEWLPSSTDVATQPD
IGSGRERIPQNNYTEIHIDEPETFSLGPVAPLGPSVTDVEMPAYSTFAYFATEATPHAFT
PSSEQHDSVPTVHVVHSQTTEPVSNGETPLQPSYSSEVFPLATPLLLDNQILNTTPAASS
SDSALHATPVFPSVDVSFEPILSSYDGAPLLPFSSASFSSERFRHLHTVSQTLPQVPSAA
DSDQVPLHASLPLAVGDLLLEPSLAQYSDVVSHQTTAHAASETLELGSESGVLYKTRVFS
QAEPSSSAVVMHEPPSAFFHLKIPQHFSGSHSSAIPVHDSLDVSEQGFLSSSPSRLSIPK
SSIAPTASVLQPTHALSGDGGWSGTFSDSESLLLDTDGLTALKISSPVSLAEFTYSTSLV
GDDNKPLSKSEIIYGNELQNSTFSDMVYHSKKTAVPETSIFMSSTESMLPGSPAYTTTKA
LEYEISQVQSTHAVSPEVDDTSLRLVLRAKSEPASSDPASSDVFPPSTQLLDYEASTSFN
PEGLLQPSFQASAVDTMLKIALPTVSSEPIQVEFPKVDKIGSTILHPMTSDSASSESMSH
STSLPVFDLLPTSNMYSASPQDLTVSYASEKFFQEVLLKSESSQQIISSLYSKDELLQTT
SLESNQAFPPEGSLTFVSTILPMDERPNTLTTKLVYSEEVSTSTTISITDKVSASIPTLA
SSSLVSSDPSVPLGNGRVSITAVSPSQEGSVGTTELLFPSKATVEQAATARAVVDLVGGD
EDGDIDDEYGDDDEYDDKDSDGFAINKCMSCSTYRESQEKVMNESDAQENSPLDQSNQQS
YSQPPTSEKENKVLGGATDSQTAMDRRPGKSLSAGVLPGKHSGTLDSHGQSGRTLLPLTP
GSKTWAVVSSDEESGSGQGASDSFSDNETTEFSFDANEKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKC
DQYWPTDGSEEYGNFLVNQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYT
QWPDMGVPEYSLPVLTFVRKAAHAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEG
TVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEIPDSHIHAYVNALLIPGP
TGRTKLEKQFQLLSQSNIQQSDYSTALKQCNREKNRTSSIIPVERSRVGISSLSGEGTDY
INASYVMGYYQSNEFIITQHPLLHTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPN
KDEPINCESFKVSLMAEEHKCLSNEEKLIIQDFILEATQDDYVLEVRHFQCPKWPNPDSP
ISKTFELISIIKEEGANRDGPMIVHDEHGGVTAGTFCALTTLMHQLEKESSVDVYQVAKM
INLMRPGVFADV
Download sequence
Identical sequences ENSOPRP00000014118 ENSOPRP00000014118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]