SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014257 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014257
Domain Number 1 Region: 1-78,112-176,207-290
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.96e-26
Family ADP-ribosylglycohydrolase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014257   Gene: ENSOPRG00000015614   Transcript: ENSOPRT00000015607
Sequence length 290
Comment pep:novel genescaffold:pika:GeneScaffold_3078:57:63160:-1 gene:ENSOPRG00000015614 transcript:ENSOPRT00000015607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERFQAAMVLGAVGDALGYGHTGRENGTGGLGHLVLSPAEWPVSDNTIMHMATAEALTTX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGFGA
ATKAMCIGLRYWKPERLDTLVEVSIECGRMTHNHPTXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXYQEHWFYFEAKWQFYLEERKISEDTENKAVFPDNYN
AEERDRTYRKWSSEGRGGRRGHDAPMIAYDALLAAGSSWDELCRHAMFHG
Download sequence
Identical sequences ENSOPRP00000014257 ENSOPRP00000014257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]