SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014268 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014268
Domain Number 1 Region: 459-479,519-623,737-779
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.56e-31
Family Phosphate binding protein-like 0.0002
Further Details:      
 
Domain Number 2 Region: 70-440
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.51e-20
Family L-arabinose binding protein-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014268   Gene: ENSOPRG00000015609   Transcript: ENSOPRT00000015618
Sequence length 1057
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2300:232691:383106:-1 gene:ENSOPRG00000015609 transcript:ENSOPRT00000015618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLQPWTTSPSASAPDGSRAGSQRHEPEPGTWRPAPSPGARWLGSALHGRGRQGTRKPEEG
TGAETLWPRDALLFAVDNLNRVDGLLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSD
PFSFLQSVCHTVVVQGVSALLAFPQSQGEMMELDLVSSVLHIPVISIVRHEFPRESQNPL
HLQLSLENSLSSDADVTISILTMNNWYNFSLLLCQEEWNITDFLLLTQNNSKFHLGSIIN
ITANLSSTKDLLGFLQGQLESVKNSTPTMVMFGCDMESIRRIFEITTQFVLSPSELRWVL
GDSQNVEELRTEGLPLGLIAHGKTTQSVFEYYVQDAMELVARAVATATMIQPELALIPST
MNCMDVKTTNLTSGQYLSRFLANTTFRGLSGFIKVKGSTIISSENNFFIWNLQHDPMGKP
MWTRLGSWQGGKIVMDYGIWSEQAQRHKTHFQHPNKLHLRVVTLIEHPFVFTREVDDEGL
CPAGQLCLHPLTNDSSILDNLFKSLHSSNDTVPIKFKKCCYGYCIDLLEKLAEDMNFDFD
LYIVGDGKYGAWKNGHWTGLVGDLLSGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGIL
VRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRSKVFSF
SSGLNVCYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEE
LSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVQYLXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYIGLPPNSPLTSNISELISXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXTLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYR
LLLPRIKNKSKLQYWLHTSQRLHRAXXXXXXXXXXXXXXXXXXXXXSSVAPRQLMVWNTS
SLSHDNQQKYIFGEEGRQNQLGIQTHQDIPLPLRRELPASLTTNGKADSINVARNSVMQE
LSELEKQIQVIRQELQLAVSRKTELEEYQRTNRTCES
Download sequence
Identical sequences ENSOPRP00000014268 ENSOPRP00000014268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]